PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05546
Common NameKK1_005684
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 234aa    MW: 26951.3 Da    PI: 7.7019
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05546genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.91e-171055147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed  l+++v+++G ++W+ I++ ++ gR++k+c++rw + 
    C.cajan_05546 10 KGSWSPQEDATLLKLVNEHGARNWSVISSGIP-GRSGKSCRLRWCNQ 55
                     799*****************************.***********985 PP

2Myb_DNA-binding55.99.9e-1864106347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed ++v+a++ +G++ W+tI+r ++ gRt++ +k++w++ 
    C.cajan_05546  64 PFTPAEDRIIVKAHAIHGNK-WATISRLLP-GRTDNAIKNHWNST 106
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.611556IPR017930Myb domain
SuperFamilySSF466894.67E-308103IPR009057Homeodomain-like
SMARTSM007171.6E-15958IPR001005SANT/Myb domain
PfamPF002496.4E-181055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-241163IPR009057Homeodomain-like
CDDcd001676.94E-141254No hitNo description
PROSITE profilePS5129424.67457111IPR017930Myb domain
SMARTSM007174.8E-1561109IPR001005SANT/Myb domain
CDDcd001671.08E-1164107No hitNo description
PfamPF002491.3E-1464106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2264109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MIDSGDDRVK GSWSPQEDAT LLKLVNEHGA RNWSVISSGI PGRSGKSCRL RWCNQLSPEV  60
QHRPFTPAED RIIVKAHAIH GNKWATISRL LPGRTDNAIK NHWNSTLRRH RAASASSDSP  120
PPPAKRPSVF DTFRPLKKLC IEKETEEERL ASTVTTSLSL FPPGERSEED EEEKEKEEEF  180
EVNTIMSDNQ KRFIQVIRRM IAEEVRNYFH TLRLQERDNP FLQHDLDFHP IVPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-3791093103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014625530.11e-100PREDICTED: transcription factor MYB44 isoform X2
RefseqXP_003518439.11e-100PREDICTED: transcription factor MYB44 isoform X1
TrEMBLA0A151U1721e-174A0A151U172_CAJCA; Transcription factor MYB44
STRINGGLYMA02G43280.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.14e-51myb domain protein 77